The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the CNH domain shown below is 2e-4.
MFATVAGISQRAPVHWSENVIGAAVCFPYVIALDDEFITVHSMLDQQQKQTL
CNH |
---|
PFAM accession number: | PF00780 |
---|---|
Interpro abstract (IPR001180): | Based on sequence similarities a domain of homology has been identified in the following proteins [ (PUBMED:10391936) ]:
This domain, called the citron homology domain, is often found after cysteine rich and pleckstrin homology (PH) domains at the C-terminal end of the proteins [ (PUBMED:10391936) ]. It acts as a regulatory domain and could be involved in macromolecular interactions [ (PUBMED:10391936) (PUBMED:9135144) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNH