The domain within your query sequence starts at position 6 and ends at position 283; the E-value for the CN_hydrolase domain shown below is 3.2e-52.
TVATCALNQWALDFEGNFQRILKSIQIAKGKGARYRLGPELEICGYGCWDHYHESDTLLH SLQVLAALLDSPVTQDIICDVGMPIMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRE LRWFTPWTRSRQTEEYVLPRMLQDLTKQKTVPFGDVVLATQDTCVGSEICEELWTPRSPH IDMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLANQKGCDGDRLYYDGC AMIAMNGSIFAQGTQFSLDDVEVLTATLDLEDVRSYKA
CN_hydrolase |
![]() |
---|
PFAM accession number: | PF00795 |
---|---|
Interpro abstract (IPR003010): | The carbon-nitrogen hydrolase domain is an around 265-residue domain found in numerous enzymes involved in the reduction of organic nitrogen compounds and ammonia production. Based on their sequence similarity and on the reactions they catalyse, these enzymes can be classified into functionally distinct groups including [ (PUBMED:7987228) (PUBMED:12054553) ]:
The carbon-nitrogen hydrolase domain is characterised by several conserved motifs, one of which contains a cysteines that is part of the catalytic site in nitrilases. Another highly conserved motif includes a glutamic acid that might also be involved in catalysis [ (PUBMED:7987228) ]. |
GO process: | nitrogen compound metabolic process (GO:0006807) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CN_hydrolase