The domain within your query sequence starts at position 17 and ends at position 247; the E-value for the COE1_DBD domain shown below is 8e-150.
EEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYD RQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTK QAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQ NCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRL
COE1_DBD |
![]() |
---|
PFAM accession number: | PF16422 |
---|---|
Interpro abstract (IPR032200): | This entry represents the DNA-binding domain of COE1, COE2, COE3 and COE4 (also known as Ebf1, Ebf2, Ebf3 and Ebf4), they belong to the early B cell factor family. COE1 is a key transcriptional determinant of B-lymphocyte differentiation [ (PUBMED:20876732) ]. COE3 is a transcription factor involved in neuronal differentiation and maturation [ (PUBMED:28017373) ]. |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COE1_DBD