The domain within your query sequence starts at position 1 and ends at position 156; the E-value for the COG4 domain shown below is 6.3e-43.
MRNSATEKIEPRELDPVLTEVTLMNARSELYLRFLRKRISADFEVGDSMASEEVKQEHQK CLDKLLNNCLLSCTMQELIGFYITMEEYFMRETVNKAVALDTYEKGQLTSSMVDDVFYIV KKCIGRALSSSNIDCLCAMINLATRELEADFRTSSV
COG4 |
![]() |
---|
PFAM accession number: | PF08318 |
---|---|
Interpro abstract (IPR013167): | This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi and intra Golgi transport [ (PUBMED:12006647) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG4