SMART: Pfam domain COMP

The domain within your query sequence starts at position 226 and ends at position 270; the E-value for the COMP domain shown below is 8.2e-26.

EQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCG

COMP

PFAM accession number:	PF11598
Interpro abstract (IPR024665):	Thrombospondins are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. Cartilage oligomeric matrix protein may play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as collagen and fibronectin [ (PUBMED:11084047) (PUBMED:12225811) ]. Thrombospondin 3 and 4 and cartilage oligomeric matrix proteins contain a five-stranded coiled-coil domain represented by this entry. This domain has a binding site between two internal rings formed by Leu37 and Thr40 [ (PUBMED:9736606) ].

PFAM accession number:

PF11598

Interpro abstract (IPR024665):

Thrombospondins are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. Cartilage oligomeric matrix protein may play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as collagen and fibronectin [ (PUBMED:11084047) (PUBMED:12225811) ].

Thrombospondin 3 and 4 and cartilage oligomeric matrix proteins contain a five-stranded coiled-coil domain represented by this entry. This domain has a binding site between two internal rings formed by Leu37 and Thr40 [ (PUBMED:9736606) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COMP