The domain within your query sequence starts at position 226 and ends at position 270; the E-value for the COMP domain shown below is 8.2e-26.
EQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCG
COMP |
![]() |
---|
PFAM accession number: | PF11598 |
---|---|
Interpro abstract (IPR024665): | Thrombospondins are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. Cartilage oligomeric matrix protein may play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as collagen and fibronectin [ (PUBMED:11084047) (PUBMED:12225811) ]. Thrombospondin 3 and 4 and cartilage oligomeric matrix proteins contain a five-stranded coiled-coil domain represented by this entry. This domain has a binding site between two internal rings formed by Leu37 and Thr40 [ (PUBMED:9736606) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COMP