The domain within your query sequence starts at position 844 and ends at position 1046; the E-value for the COR domain shown below is 4.7e-26.
PRSYISLQEAVLAEQQRRSLGDQVQYLTDRQLDQLVEQTPGNDIKDYEDLQSAISFLIET GTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIQAEDLRMLLVGTGF TQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHSMRHPMANTIQRVFKMSFV PVGFWQRFIARMLISLAEMDLQL
COR |
---|
PFAM accession number: | PF16095 |
---|---|
Interpro abstract (IPR032171): | The C-terminal of Roc domain, or COR domain, functions along with Roc as a putative regulator of kinase activity. It functions as a proper GTP-binding protein with a low GTPase activity somehow stimulating the kinase activity [ (PUBMED:18650931) ]. The Roc-COR tandem is found in bacterial and eukaryotic proteins. Its most prominent member is the leucine-rich repeat kinase LRRK2 [ (PUBMED:18230735) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COR