SMART: Pfam domain COR

The domain within your query sequence starts at position 844 and ends at position 1046; the E-value for the COR domain shown below is 4.7e-26.

PRSYISLQEAVLAEQQRRSLGDQVQYLTDRQLDQLVEQTPGNDIKDYEDLQSAISFLIET
GTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIQAEDLRMLLVGTGF
TQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHSMRHPMANTIQRVFKMSFV
PVGFWQRFIARMLISLAEMDLQL

COR

PFAM accession number:	PF16095
Interpro abstract (IPR032171):	The C-terminal of Roc domain, or COR domain, functions along with Roc as a putative regulator of kinase activity. It functions as a proper GTP-binding protein with a low GTPase activity somehow stimulating the kinase activity [ (PUBMED:18650931) ]. The Roc-COR tandem is found in bacterial and eukaryotic proteins. Its most prominent member is the leucine-rich repeat kinase LRRK2 [ (PUBMED:18230735) ].

PFAM accession number:

PF16095

Interpro abstract (IPR032171):

The C-terminal of Roc domain, or COR domain, functions along with Roc as a putative regulator of kinase activity. It functions as a proper GTP-binding protein with a low GTPase activity somehow stimulating the kinase activity [ (PUBMED:18650931) ]. The Roc-COR tandem is found in bacterial and eukaryotic proteins. Its most prominent member is the leucine-rich repeat kinase LRRK2 [ (PUBMED:18230735) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COR