The domain within your query sequence starts at position 73 and ends at position 402; the E-value for the COX15-CtaA domain shown below is 2.3e-112.
GRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQKYQQFPE FKILNHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLNRGMKGRVLALCG LVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPQH KLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLLTFS PVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIPLPRRTKMAAVTLLALAYAQVA LGISTLLMYVPTPLAATHQSGSLALLSGAL
COX15-CtaA |
![]() |
---|
PFAM accession number: | PF02628 |
---|---|
Interpro abstract (IPR003780): | In some cases, heme A synthase is found fused to protoheme IX farnesyltransferase, an enzyme that converts protoheme IX to heme O. This is a family of integral membrane proteins. CtaA (also known as heme A synthase) is required for cytochrome aa3 oxidase assembly in Bacillus subtilis [ (PUBMED:2549006) ]. COX15 is required for cytochrome c oxidase assembly in yeast [ (PUBMED:9228094) ], and may also be involved in the synthesis of heme A [ (PUBMED:12474143) ]. |
GO process: | oxidation-reduction process (GO:0055114), heme A biosynthetic process (GO:0006784) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX15-CtaA