The domain within your query sequence starts at position 16 and ends at position 73; the E-value for the COX16 domain shown below is 6.9e-16.

LRYGVPMLLLVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKITLESEYEFLLIY

COX16

COX16
PFAM accession number:PF14138
Interpro abstract (IPR020164):

Cytochrome c oxidase assembly protein COX16 is required for the assembly of cytochrome c oxidase [ (PUBMED:12446688) ]. It is found in the inner membrane of the mitochondrion.

GO component:mitochondrial membrane (GO:0031966)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX16