The domain within your query sequence starts at position 16 and ends at position 88; the E-value for the COX16 domain shown below is 1.8e-24.
LRYGVPMLLLVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKITLESEYEKIKDSTF ENWKNIRGPRPWE
COX16 |
![]() |
---|
PFAM accession number: | PF14138 |
---|---|
Interpro abstract (IPR020164): | Cytochrome c oxidase assembly protein COX16 is required for the assembly of cytochrome c oxidase [ (PUBMED:12446688) ]. It is found in the inner membrane of the mitochondrion. |
GO component: | mitochondrial membrane (GO:0031966) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX16