The domain within your query sequence starts at position 15 and ends at position 63; the E-value for the COX17 domain shown below is 7.3e-28.
QEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
COX17 |
 |
|---|
| PFAM accession number: | PF05051 |
|---|---|
| Interpro abstract (IPR007745): | Cox17p is essential for the assembly of functional cytochrome c oxidase (CCO) and for delivery of copper ions to the mitochondrion for insertion into the enzyme in Saccharomyces cerevisiae [ (PUBMED:12370308) ]. |
| GO process: | copper ion transport (GO:0006825) |
| GO component: | mitochondrial intermembrane space (GO:0005758) |
| GO function: | copper ion binding (GO:0005507), copper chaperone activity (GO:0016531) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX17