The domain within your query sequence starts at position 1 and ends at position 47; the E-value for the CPT_N domain shown below is 2.3e-30.

MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFK

CPT_N

• PFAM accession number: PF16484
• Interpro abstract (IPR032476):

  This domain is found at the N terminus of carnitine O-palmitoyltransferases. It functions as a regulatory domain and is linked to the catalytic domain via two transmembrane regions [ (PUBMED:21990363) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CPT_N