The domain within your query sequence starts at position 164 and ends at position 310; the E-value for the CREPT domain shown below is 1.1e-59.

LDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLEKITDKESGERLSKMVEDACMLL
ADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRARI
QSLPDLSRLPNVTGSHMHLPFAGDIYS

CREPT

CREPT
PFAM accession number:PF16566
Interpro abstract (IPR032337):

CREPT (Cell-cycle alteration and expression-elevated protein in tumour), also known as RPRD (regulation of nuclear pre-mRNA domain-containing protein) is a family of eukaryotic transcriptional regulators that promote the binding of RNA-polymerase to the CYCLIN D1, CCDN1, promoter and other genes involved in the cell-cycle [ (PUBMED:22231121) ]. It promotes the formation of a chromatin loop in the CYCLIN D1 gene, and is preferentially expressed in a range of different human tumours [ (PUBMED:22264791) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CREPT