The domain within your query sequence starts at position 55 and ends at position 129; the E-value for the CS domain shown below is 4.7e-7.
LLDWRQSADEVIVKLRVGTGPVRLEDVDAAFTDTDCVVRLPDGRQWGGVFFAEIQSSCTK VQARKGGLLQLVLPK
CS |
---|
PFAM accession number: | PF04969 |
---|---|
Interpro abstract (IPR007052): | The bipartite CS domain, which was named after CHORD-containing proteins and SGT1 [ (PUBMED:10571178) ], is a ~100-residue protein-protein interaction module. The CS domain can be found in stand-alone form, as well as fused with other domains, such as CHORD ( IPR007051 ), SGS ( IPR007699 ), TPR ( IPR019734 ), cytochrome b5 ( IPR001199 ) or b5 reductase, in multidomain proteins [ (PUBMED:12372593) ]. The CS domain has a compact antiparallel beta-sandwich fold consisting of seven beta-strands [ (PUBMED:12372593) (PUBMED:14761955) ]. Some proteins known to contain a CS domain are listed below [ (PUBMED:12372593) ]:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CS