The domain within your query sequence starts at position 194 and ends at position 338; the E-value for the CTP_transf_like domain shown below is 5.3e-11.

AVGGTFDRLHNAHKVLLSVACVLAQEQLVVGVADKDLLKSKLLPELLQPYAERVEHLTEF
LVDIKPSLTFELVPLLDPYGPAGSDPTLEFLVVSEETYRGGMAVNRFRLENGKEELALYQ
IQLLKDQSHNENEEDKVSSSSFRQR

CTP_transf_like

 CTP_transf_like
PFAM accession number:PF01467
Interpro abstract (IPR004821):

Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase [ (PUBMED:16344011) ], ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, archaeal FAD synthase RibL [ (PUBMED:20822113) ], and a number whose function is unknown. Many of these proteins are known to use CTP or ATP and release pyrophosphate.

GO process:biosynthetic process (GO:0009058)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTP_transf_like