The domain within your query sequence starts at position 685 and ends at position 768; the E-value for the Cadherin_C_2 domain shown below is 4.8e-24.
DLTLYLVVAVAVVSCIFLAFVIVLLALRLRRWYSSRLQASGNGLAGIPASHFVGLDGVQA FLQTYSQEVSLTAGSRKSHLIFPQ
Cadherin_C_2 |
---|
PFAM accession number: | PF16492 |
---|---|
Interpro abstract (IPR032455): | This entry represents the cytoplasmic C-terminal domain of some proto-cadherins. It is this region of the cadherins that allows cell-adhesion and the essential feature of metazoan multicellularity. Cadherins are cell-surface receptors that function in cell adhesion, cell polarity, and tissue morphogenesis [ (PUBMED:1568244) (PUBMED:22837400) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cadherin_C_2