The domain within your query sequence starts at position 317 and ends at position 618; the E-value for the Caprin-1_C domain shown below is 1.2e-32.
QGTYNFMQESVLDFDKPSSAIPSSQPPSACPVSTVSAEQNLSNQSDFLQEPSQASSPVTC SSNACLVTTDQASSGSETEFTTSETPEMVVSPCKPKPASALASPNPPLSKSFQLPPASGS SEAISTAPFQAMQTVFNVNAPLPPRKEQEMKEPPYSSGYNQNFTSSSTQTVSQCQLPAVH IDQTTQPPETGAGYHPDGTVQVSNGSLAFYPAPTSMFPRPAQPFISSRGTLRGCSHGGRL LMSSYQSPGGYKGFDSYRGLPSVSSGNYSQLQLQAREYSGTAYSQRDNFQQCYKRSGTSS GL
Caprin-1_C |
![]() |
---|
PFAM accession number: | PF12287 |
---|---|
Interpro abstract (IPR022070): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C-terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C-terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Caprin-1_C