The domain within your query sequence starts at position 183 and ends at position 502; the E-value for the Carboxyl_trans domain shown below is 2.7e-127.
LDTSYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNF LPLSSQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYA KNIVVGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGF LPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPT AEIAVMGAKGAVEIIFKGHQDVEAAQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARICC DLEVLASKKVHRPWRKHANI
Carboxyl_trans |
![]() |
---|
PFAM accession number: | PF01039 |
---|---|
Interpro abstract (IPR034733): | All of the members in this family are biotin dependent carboxylases [ (PUBMED:8102604) (PUBMED:8366018) ]. The carboxyl transferase domain carries out the following reaction; transcarboxylation from biotin to an acceptor molecule. There are two recognised types of carboxyl transferase. One of them uses acyl-CoA and the other uses 2-oxoacid as the acceptor molecule of carbon dioxide. All of the members in this family utilise acyl-CoA as the acceptor molecule. In bacteria, the acetyl coenzyme A carboxylase (ACC) is a complex consisting of two subunits: alpha and beta. This domain also recognizes the bacterial ACC beta-subunit. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Carboxyl_trans