The domain within your query sequence starts at position 3 and ends at position 148; the E-value for the Carn_acyltransf domain shown below is 3.5e-34.
SPPQPGEEKLAALTAGGRVEWAEARQTFFSSGKNKMSLDAIERAAFFVTLDEDSHCYNPD DETSLSLYGKALLHGNCYNRWFDKSFTLISCKNGLLGLNTEHSWADAPIIGHLWEDTVWV SQTPRCHPLSGCRGTFPSSAGKPSRT
Carn_acyltransf |
![]() |
---|
PFAM accession number: | PF00755 |
---|---|
Interpro abstract (IPR039551): | This domain is also found at the C terminus of highly reducing polyketide synthase SdnO. SdnO is part of the gene cluster that mediates the biosynthesis of glycoside antibiotics sordarin and hypoxysordarin [ (PUBMED:27072286) ]. The choline/carnitine acyltransferase domain is found in a number of eukaryotic acetyltransferases. These enzymes include:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Carn_acyltransf