The domain within your query sequence starts at position 29 and ends at position 229; the E-value for the Casc1_N domain shown below is 5.5e-61.
RRLKEEEEARLKFEKEEQERLEIQRIEREKWSLLEKKDLERRSQELEELALLEGCFPEAE KQKREIRALAQWKHYTECDGSPDPWVAQEMNTFISLWEEEKNQAFEQVMEKSKLVLSLIE KVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLRQASNLADLDTGNME KIIKDENVTLYVWANLKKNPR
Casc1_N |
![]() |
---|
PFAM accession number: | PF15927 |
---|---|
Interpro abstract (IPR031826): | This domain is found in CASC1 (cancer susceptibility candidate gene 1 protein) [ (PUBMED:16862160) ], a protein of unknown function. There are two completely conserved residues (N and W) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Casc1_N