The domain within your query sequence starts at position 55 and ends at position 133; the E-value for the Casein domain shown below is 5.1e-17.
YIPQMESVEAPMKVSDIISQQQYNQKMMDMSKTVMTEESKNIQDYMNKMKRYSKITWPQF VKLLHQYQKTMTPWSYYPS
Casein |
![]() |
---|
PFAM accession number: | PF00363 |
---|---|
Interpro abstract (IPR001588): | Caseins [ (PUBMED:3074304) ] are the major protein constituent of milk. In milk, caseins interact with calcium phosphate, forming large stable colloidal particles termed micelles. These micelles make it possible to maintain a supersaturated calcium phosphate concentration in milk, providing the newborn with sufficient calcium phosphate for the mineralisation of calcified tissues [ (PUBMED:7619062) ]. Caseins can be classified into two families; the first consists of the kappa-caseins, and the second groups the alpha-s1, alpha-s2, and beta-caseins. The alpha/beta caseins are a rapidly diverging family of proteins [ (PUBMED:16386026) (PUBMED:3952000) ]. However two regions are conserved: a cluster of phosphorylated serine residues and the signal sequence. Alpha-s2 casein is known as epsilon-casein in mouse, gamma-casein in rat and casein-A in guinea pig. Alpha-s1 casein is known as alpha-casein in rat and rabbit and as casein-B in guinea pig. |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Casein