The domain within your query sequence starts at position 34 and ends at position 260; the E-value for the Cation_efflux domain shown below is 5.7e-30.

ILLFGAINVLCTGFLLMWCSSTNSIALTAYTYLTIFDLFSLFFFSLITCLISYWVMMRKP
SPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALSFN
LFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGLIPGLSSIFLPRMNPFVLIDLAG
AFALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLL

Cation_efflux

Cation_efflux
PFAM accession number:PF01545
Interpro abstract (IPR002524):

Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt. These proteins are considered to be efflux pumps that remove these ions from cells [ (PUBMED:9696746) (PUBMED:8829543) ], however others are implicated in ion uptake [ (PUBMED:1508175) ]. The family has six predicted transmembrane domains. Members of the family are variable in length because of variably sized inserts, often containing low-complexity sequence.

GO process:cation transport (GO:0006812), transmembrane transport (GO:0055085)
GO component:integral component of membrane (GO:0016021)
GO function:cation transmembrane transporter activity (GO:0008324)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cation_efflux