The domain within your query sequence starts at position 1 and ends at position 133; the E-value for the Cep57_CLD domain shown below is 1.6e-43.
XIQERENSKNEESKHNQELASQLVAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVS LERERQHDQTHVQSQLEKLDLLEQEYNKLTAMQALAEKKMQELESKLREEEQERKRMQAR AAESGLEANRLIF
Cep57_CLD |
---|
PFAM accession number: | PF14073 |
---|---|
Interpro abstract (IPR025913): | The CLD or centrosome localisation domain of Cep57 is found at the N terminus, and lies approximately between residues 58 and 239. This region lies within the first alpha-helical coiled-coil segment of Cep57, and localises to the centrosome internally to gamma-tubulin, suggesting that it is either on both centrioles or on a centromatrix component [ (PUBMED:18294141) ]. This N-terminal region can also multimerise with the N terminus of other Cep57 molecules. |
GO function: | identical protein binding (GO:0042802), gamma-tubulin binding (GO:0043015) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cep57_CLD