The domain within your query sequence starts at position 68 and ends at position 245; the E-value for the Cep57_CLD domain shown below is 2.1e-72.

AIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQ
ELASQLVAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLE
KLDLLEQEYNKLTAMQALAEKKMQELESKLREEEQERKRMQARAAELQSGLEANRLIF

Cep57_CLD

• PFAM accession number: PF14073
• Interpro abstract (IPR025913):

  The CLD or centrosome localisation domain of Cep57 is found at the N terminus, and lies approximately between residues 58 and 239. This region lies within the first alpha-helical coiled-coil segment of Cep57, and localises to the centrosome internally to gamma-tubulin, suggesting that it is either on both centrioles or on a centromatrix component [ (PUBMED:18294141) ]. This N-terminal region can also multimerise with the N terminus of other Cep57 molecules.

• GO function: gamma-tubulin binding (GO:0043015), identical protein binding (GO:0042802)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cep57_CLD