The domain within your query sequence starts at position 8 and ends at position 172; the E-value for the Ceramidase domain shown below is 5.5e-63.
KGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLEKRYIAAY LALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYHLLFTLFL YSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTCVSPESC
Ceramidase |
![]() |
---|
PFAM accession number: | PF05875 |
---|---|
Interpro abstract (IPR008901): | This entry consists of several ceramidases. Ceramidases are enzymes involved in regulating cellular levels of ceramides, sphingoid bases, and their phosphates [ (PUBMED:11356846) ]. |
GO process: | ceramide metabolic process (GO:0006672) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides (GO:0016811) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ceramidase