The domain within your query sequence starts at position 29 and ends at position 184; the E-value for the Chlorophyllase2 domain shown below is 1.9e-8.
KMRFAVYLPPQAESGKCPALYWLSGLTCTEQNFISKSGYQQAASEHGLVVIAPDTSPRGC NIKGEDDSWDFGTGAGFYVNATEDPWKANYRMYSYVTEELPQLINANFPVDPQRMSIFGH SMGGHGALICALKNPGKYRSVSAFAPICNPVLCSWG
Chlorophyllase2 |
![]() |
---|
PFAM accession number: | PF12740 |
---|---|
Interpro abstract (IPR041127): | This family consists of several chlorophyllase and chlorophyllase-2 ( EC 3.1.1.14 ) enzymes. Chlorophyllase (Chlase) is the first enzyme involved in chlorophyll (Chl) degradation and catalyses the hydrolysis of an ester bond to yield chlorophyllide and phytol [ (PUBMED:10611389) ]. The family includes both plant and Amphioxus members. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chlorophyllase2