The domain within your query sequence starts at position 358 and ends at position 536; the E-value for the CoaE domain shown below is 1.7e-43.
YVLGLTGISGSGKSSVAQRLKNLGAYIIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKD GTINRKVLGSRVFGNKKQMKILTDIVWPVIAKLAREEMDVAVAKGKTLCVIDAAMLLEAG WQSMVHEVWTVVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSNVVLSTLWE
CoaE |
---|
PFAM accession number: | PF01121 |
---|---|
Interpro abstract (IPR001977): | This family contains Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24 ), which catalyzes the final step in dephosphocoenzyme A (dCoA) biosynthesis, the phosphorylation of the 3'-hydroxyl group of ribose using ATP as a phosphate donor. The crystal structures of a number of the proteins in this entry have been determined, including the structure of the protein from Haemophilus influenzae to 2.0-A resolution in a comlex with ATP. The protein consists of three domains: the nucleotide-binding domain with a five-stranded parallel beta-sheet, the substrate-binding alpha-helical domain, and the lid domain formed by a pair of alpha-helices; the overall topology of the protein resembles the structures of other nucleotide kinases [ (PUBMED:11886213) ]. |
GO process: | coenzyme A biosynthetic process (GO:0015937) |
GO function: | dephospho-CoA kinase activity (GO:0004140), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CoaE