The domain within your query sequence starts at position 786 and ends at position 906; the E-value for the Codanin-1_C domain shown below is 2.4e-48.
EHGLDSVPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFVRKITPTTTSSLGALPL QTSQGLQAQLAEAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVHQAESLLQEQ L
Codanin-1_C |
![]() |
---|
PFAM accession number: | PF15296 |
---|---|
Interpro abstract (IPR028171): | This domain is found near to the C terminus of codanin-1 [ (PUBMED:12434312) ]. Codanin-1 may act as a negative regulator of histone chaperone anti-silencing function 1 (ASF1) in chromatin assembly [ (PUBMED:22407294) ]. Proteins containing this domain also include the protein disks lost (dlt, also known as protein vanaso) from Drosophila. dlt regulates cell proliferation and cell survival of differentiated cells independent of cell division [ (PUBMED:14667407) ]. Mutations in the codanin-1 gene cause congenital dyserythropoietic anemia 1 (CDA1), which is an autosomal recessive blood disorder characterised by morphological abnormalities of erythroblasts, ineffective erythropoiesis, macrocytic anemia and secondary hemochromatosis [ (PUBMED:12434312) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Codanin-1_C