The domain within your query sequence starts at position 1 and ends at position 106; the E-value for the Coiled-coil_56 domain shown below is 1.8e-56.
MAAPGAGDPLNAKNGNAPFAQRIDPSREKLTPAQLQFMRQVQLAQWQKTLPQRRTRNIMT GLGIGALVLAIYGYTFYSVAQERFLDELEDEAKAARARALERERAS
Coiled-coil_56 |
![]() |
---|
PFAM accession number: | PF09813 |
---|---|
Interpro abstract (IPR018628): | This entry represents a coiled-coil domain found in cytochrome c oxidase assembly factor 3 and homologues. Cytochrome c oxidase assembly factor 3, previously known as coiled coil domain-containing protein 56 (CCDC56), plays a critical role in the biogenesis and activity of cytochrome c oxidase (COX) [ (PUBMED:22610097) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coiled-coil_56