SMART: Pfam domain Coiled-coil

The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the Coiled-coil_56 domain shown below is 2.7e-35.

MAAPGAGDPLNAKNGNAPFAQRIDPSREKLTPAQLQFMRQVQLAQWQKTLPQRRTRNIMT
GLGIGALVLAIYEA

Coiled-coil_56

PFAM accession number:	PF09813
Interpro abstract (IPR018628):	This entry represents a coiled-coil domain found in cytochrome c oxidase assembly factor 3 and homologues. Cytochrome c oxidase assembly factor 3, previously known as coiled coil domain-containing protein 56 (CCDC56), plays a critical role in the biogenesis and activity of cytochrome c oxidase (COX) [ (PUBMED:22610097) ].

PFAM accession number:

PF09813

Interpro abstract (IPR018628):

This entry represents a coiled-coil domain found in cytochrome c oxidase assembly factor 3 and homologues.

Cytochrome c oxidase assembly factor 3, previously known as coiled coil domain-containing protein 56 (CCDC56), plays a critical role in the biogenesis and activity of cytochrome c oxidase (COX) [ (PUBMED:22610097) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coiled-coil_56