The domain within your query sequence starts at position 193 and ends at position 236; the E-value for the Complex1_49kDa domain shown below is 2e-21.

DIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQML

Complex1_49kDa

Complex1_49kDa
PFAM accession number:PF00346
Interpro abstract (IPR001135):

This entry represents the subunit D (NuoD) of NADH-quinone oxidoreductase ( EC 1.6.99.5 ) and the subunit H (NdhH) of NAD(P)H-quinone oxidoreductase ([intenz:1.6.5.-]). NADH-quinone (Q) oxidoreductase is a large and complex redox proton pump, which utilises the free energy derived from oxidation of NADH with lipophilic electron/proton carrier Q to translocate protons across the membrane to generate an electrochemical proton gradient [ (PUBMED:11695831) ]. Subunit D (NuoD) is a 49kDa polypeptide that appears to be evolutionarily important in determining the physiological function of complex I/NDH-1 [ (PUBMED:11695831) ].

GO process:oxidation-reduction process (GO:0055114)
GO function:NAD binding (GO:0051287), oxidoreductase activity, acting on NAD(P)H (GO:0016651), quinone binding (GO:0048038)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Complex1_49kDa