The domain within your query sequence starts at position 193 and ends at position 236; the E-value for the Complex1_49kDa domain shown below is 2e-21.
DIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQML
Complex1_49kDa |
![]() |
---|
PFAM accession number: | PF00346 |
---|---|
Interpro abstract (IPR001135): | This entry represents the subunit D (NuoD) of NADH-quinone oxidoreductase ( EC 1.6.99.5 ) and the subunit H (NdhH) of NAD(P)H-quinone oxidoreductase ([intenz:1.6.5.-]). NADH-quinone (Q) oxidoreductase is a large and complex redox proton pump, which utilises the free energy derived from oxidation of NADH with lipophilic electron/proton carrier Q to translocate protons across the membrane to generate an electrochemical proton gradient [ (PUBMED:11695831) ]. Subunit D (NuoD) is a 49kDa polypeptide that appears to be evolutionarily important in determining the physiological function of complex I/NDH-1 [ (PUBMED:11695831) ]. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | NAD binding (GO:0051287), oxidoreductase activity, acting on NAD(P)H (GO:0016651), quinone binding (GO:0048038) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Complex1_49kDa