The domain within your query sequence starts at position 9 and ends at position 63; the E-value for the Complex1_LYR domain shown below is 2.1e-16.

RQVLSLYRELLRAGRGTPGAEARVRAEFRQHASLPRTDVLRIEYLYRRGRRQLQL

Complex1_LYR

 Complex1_LYR
PFAM accession number:PF05347
Interpro abstract (IPR008011):

Proteins in this family include an accessory subunit of the higher eukaryotic NADH dehydrogenase complex. In Saccharomyces cerevisiae, the Isd11 protein ( Q6Q560 ) has been shown to play a role in Fe/S cluster biogenesis in mitochondria [ (PUBMED:16341090) (PUBMED:16341089) ]. We have named this family LYR after a highly conserved tripeptide motif close to the N terminus of these proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Complex1_LYR