The domain within your query sequence starts at position 39 and ends at position 259; the E-value for the Coq4 domain shown below is 1.2e-98.
YPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQ ILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLDVNKVSPDTRAPTRFVDDEELAYVIQ RYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPIRLRTQSLQVLFSE LIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPP
Coq4 |
---|
PFAM accession number: | PF05019 |
---|---|
Interpro abstract (IPR007715): | Coq4 is a component of a multi-subunit COQ enzyme complex, which plays a role in the coenzyme Q (ubiquinone) biosynthetic pathway [ (PUBMED:11469793) (PUBMED:15792955) (PUBMED:17391640) ]. In budding yeasts, Coq4 plays an essential role in organising the COQ enzyme complex and is required for steady-state levels of Coq3, Coq6, Coq7 and Coq9 [ (PUBMED:19022396) ]. |
GO process: | ubiquinone biosynthetic process (GO:0006744) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coq4