The domain within your query sequence starts at position 60 and ends at position 177; the E-value for the Cor1 domain shown below is 1.8e-39.

NKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFCEQYITTFQKFDMDVQ
KFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEMQKAELQLRSRGEDE

Cor1

Cor1
PFAM accession number:PF04803
Interpro abstract (IPR006888):

This entry represents a conserved region found in the members of the FAM9 and XLR/SYCP3 families.

SYCP3, also known as COR1, is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase [ (PUBMED:10678170) (PUBMED:22346761) ].

The function of FAM9 and XLR is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cor1