The domain within your query sequence starts at position 32 and ends at position 138; the E-value for the CortBP2 domain shown below is 3.1e-34.
DVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLALQRDY EAGPGDKEKPVCTNPLSILEAVMAHCRKMQERMSAQLVAAESRQKKL
CortBP2 |
![]() |
---|
PFAM accession number: | PF09727 |
---|---|
Interpro abstract (IPR019131): | This entry represents a N-terminal domain found in cortactin-binding protein 2 and in filamin A interacting protein 1 (Filip1). In addition to being a positional candidate for autism, cortactin-binding protein 2 is expressed at highest levels in the brain in humans. Towards the C-terminal end of this protein are a series of proline-rich regions which are likely to be the points of interaction with the SH3 domain of cortactin. The human protein has six associated ankyrin repeat domains ( IPR002110 ) towards the C terminus of the protein which act as protein-protein interaction domains [ (PUBMED:11707066) ]. Filip1 controls the start of neocortical cell migration from the ventricular zone by acting through a filamin-A/F-actin axis. It may be able to induce the degradation of Filamin A [ (PUBMED:12055638) (PUBMED:15794127) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CortBP2