The domain within your query sequence starts at position 11 and ends at position 101; the E-value for the Cript domain shown below is 2e-37.
GRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS HYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Cript |
---|
PFAM accession number: | PF10235 |
---|---|
Interpro abstract (IPR019367): | The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners [ (PUBMED:16796391) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cript