The domain within your query sequence starts at position 11 and ends at position 101; the E-value for the Cript domain shown below is 2e-37.

GRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS
HYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Cript

Cript
PFAM accession number:PF10235
Interpro abstract (IPR019367):

The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners [ (PUBMED:16796391) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cript