The domain within your query sequence starts at position 60 and ends at position 183; the E-value for the Cu2_monooxygen domain shown below is 3.7e-34.

DFTLDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSST
GSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFR
DNHK

Cu2_monooxygen

Cu2_monooxygen
PFAM accession number:PF01082
Interpro abstract (IPR000323):

Copper type II, ascorbate-dependent monooxygenases [ (PUBMED:2792366) ] are a class of enzymes that requires copper as a cofactor and which uses ascorbate as an electron donor. This family contains two related enzymes, dopamine-beta-monooxygenase ( EC 1.14.17.1 ) and peptidyl-glycine alpha-amidating monooxygenase ( EC 1.14.17.3 ). There are a few regions of sequence similarities between these two enzymes, two of these regions contain clusters of conserved histidine residues which are most probably involved in binding copper.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen (GO:0016715), monooxygenase activity (GO:0004497), copper ion binding (GO:0005507)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cu2_monooxygen