The domain within your query sequence starts at position 367 and ends at position 441; the E-value for the Cul7 domain shown below is 1e-35.
RSEFSSRSGYGEYVQQTVQPGMRVRILDDYEEISAGDEGEFQQSNNGVPPVQVFWQSTGR TYWVHWHMLEILGPE
Cul7 |
![]() |
---|
PFAM accession number: | PF11515 |
---|---|
Interpro abstract (IPR021097): | The CPH domain is found in the Cullin-7, PARC and HERC2 proteins, which are all components of known or predicted E3-ubiquitin ligases. The CPH domain is a protein-protein interaction module that binds the teramerisation domain of the tumour suppressor protein p53 [ (PUBMED:17298945) ]. Structurally it forms a beta-barrel fold similar to the SH3, Tudor and KOW and domains. Unlike the SH3 and Tudor domains, which bind to small peptides, the CPH domain appears to bind to an extended surface on p53. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cul7