The domain within your query sequence starts at position 13 and ends at position 152; the E-value for the Cupin_8 domain shown below is 1.4e-22.
PLQYFKQHFLVPGRPVILEGVADHWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQ TLMTVDEFIQKFILSEAKDVGYLAQHQLFDQIPELKRDISIPDYCCLGNGEEEEITINAW FGPQGTISPLHQDPQQNFLV
Cupin_8 |
![]() |
---|
PFAM accession number: | PF13621 |
---|---|
Interpro abstract (IPR041667): | This cupin-like domain shares similarity to the JmjC domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cupin_8