The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the Cyclin_C domain shown below is 9.4e-12.
MYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCLRACQEQIEAALRESLR EAAQTAPSPV
Cyclin_C |
![]() |
---|
PFAM accession number: | PF02984 |
---|---|
Interpro abstract (IPR004367): | Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [ (PUBMED:12910258) ], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins, which are essential for the control of the cell cycle at the G1/S (start) transition, and G2/M cyclins, which are essential for the control of the cell cycle at the G2/M (mitosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed as cells exit from mitosis (at the end of the M-phase). In most species, there are multiple forms of G1 and G2 cyclins. For example, in vertebrates, there are two G2 cyclins, A and B, and at least three G1 cyclins, C, D, and E. Cyclin homologues have been found in various viruses, including Saimiriine herpesvirus 2 (Herpesvirus saimiri) and Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus). These viral homologues differ from their cellular counterparts in that the viral proteins have gained new functions and eliminated others to harness the cell and benefit the virus [ (PUBMED:11056549) ]. This is the C-terminal domain of cyclins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cyclin_C