The domain within your query sequence starts at position 162 and ends at position 262; the E-value for the Cyclin_C_2 domain shown below is 3.6e-32.
NPYRPFEGFLIDIKTRYPMLENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSA SRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKY
Cyclin_C_2 |
 |
|---|
| PFAM accession number: | PF16899 |
|---|---|
| Interpro abstract (IPR031658): | Cyclins contain two domains of similar all-alpha fold. This domain corresponds to the C-terminal domain of some cyclins, including cyclin C and cyclin H [ (PUBMED:8941715) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cyclin_C_2