The domain within your query sequence starts at position 22 and ends at position 157; the E-value for the Cyclin_N2 domain shown below is 7.2e-50.
EDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPS WKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDG SFESPHAMDMSIVLED
Cyclin_N2 |
---|
PFAM accession number: | PF16500 |
---|---|
Interpro abstract (IPR032447): | This entry represents the N-terminal domain of cyclin-A. The function of this domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cyclin_N2