The domain within your query sequence starts at position 8 and ends at position 113; the E-value for the Cylicin_N domain shown below is 4.6e-46.
KVTYGAYDNYIPVSELSKKSWNQQYFSLAFPKPPRPGKKRRSLPSQLQNNTAPVIDEEKL GVHRPPLWMHRSLMRISERPSVYLAARKGLIPKPLHFGKGESKSVG
Cylicin_N |
 |
|---|
| PFAM accession number: | PF15241 |
|---|---|
| Interpro abstract (IPR029354): | This entry represents the N-terminal of cylicin proteins. Cylicins are proteins of the sperm head cytoskeleton and may play a role in spermatid differentiation [ (PUBMED:7737358) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cylicin_N