The domain within your query sequence starts at position 35 and ends at position 118; the E-value for the Cystatin domain shown below is 3.8e-11.
VSEPDIVKFALSAFHKKSKDEYAYRVIHIMNFLKVQEEPPQTFFVKLRLTRTICMKFEKS LDTCPLPELQNILICSFSISSPGS
Cystatin |
 |
|---|
| PFAM accession number: | PF00031 |
|---|---|
| Interpro abstract (IPR000010): | Cystatins are a family of cysteine protease inhibitors belonging to MEROPS inhibitor family I25, clan IH [ (PUBMED:2107324) (PUBMED:14587292) (PUBMED:1855589) ]. They mainly inhibit peptidases belonging to peptidase families C1 (papain family) and C13 (legumain family). They occur mainly as single domain proteins. However, some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains. |
| GO function: | cysteine-type endopeptidase inhibitor activity (GO:0004869) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cystatin