The domain within your query sequence starts at position 8 and ends at position 55; the E-value for the Cytidylate_kin domain shown below is 3.5e-7.
AVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAK
Cytidylate_kin |
---|
PFAM accession number: | PF02224 |
---|---|
Interpro abstract (IPR011994): | Cytidylate kinase ( EC 2.7.4.14 ) catalyses the phosphorylation of cytidine 5'-monophosphate (dCMP) to cytidine 5'-diphosphate (dCDP) in the presence of ATP or GTP. |
GO process: | nucleobase-containing compound metabolic process (GO:0006139) |
GO function: | cytidylate kinase activity (GO:0004127), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cytidylate_kin