The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the DAP10 domain shown below is 4.7e-51.
MDPPGYLLFLLLLPVAASQTSAGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRP HGRPAQEDGRVYINMPGRG
DAP10 |
 |
|---|
| PFAM accession number: | PF07213 |
|---|---|
| Interpro abstract (IPR009861): | Hematopoietic cell signal transducer (HCST, also known as DAP10) is a transmembrane adaptor that associates with an activation receptor, NKG2D, which is found on NK and subsets of T cells. The ligands for this receptor include MHC class I chain-related (MIC) protein A and protein B and UL16-binding proteins [ (PUBMED:18097042) ]. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [ (PUBMED:12740576) ]. |
| GO process: | positive regulation of phosphatidylinositol 3-kinase signaling (GO:0014068), regulation of immune response (GO:0050776) |
| GO component: | membrane (GO:0016020) |
| GO function: | signaling receptor binding (GO:0005102), phosphatidylinositol 3-kinase binding (GO:0043548) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAP10