The domain within your query sequence starts at position 8 and ends at position 184; the E-value for the DCB domain shown below is 3e-72.
EAVKKLLENMQSDLRALSLECKKKFPPVKEAAESGIIKVKTIAARNTEILAALKENSSEV VQPFLMGCGTKEPKITQLCLAAIQRLMSHEVVSETAAGNIINMLWQLMENSLEELKLLQT VLVLLTTNTVVHDEALSKAIVLCFRLHFTKDNITNNTAAATVRQVVTVVFERMVAED
DCB |
---|
PFAM accession number: | PF16213 |
---|---|
Interpro abstract (IPR032629): | This is the N-terminal domain of Mon2- and BIG1-like proteins. The N terminus of Mon2 (Ysl2) binds to Arf-Like small GTPase Arl1, and shows homology to brefeldin A-inhibited guanine-exchange factor (BIG) domains [ (PUBMED:12052896) ]. Mon2 and BIG1-like proteins play an important role in membrane traffic and Golgi homeostasis [ (PUBMED:16219684) (PUBMED:16301316) (PUBMED:18417613) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCB