The domain within your query sequence starts at position 115 and ends at position 177; the E-value for the DCX domain shown below is 2.9e-17.
LLNRRSVQTFEQLLSDISEALGFPRWKNDRVRKLFTLKGREVKSVSDFFREGDAFIAMGK EPL
DCX |
![]() |
---|
PFAM accession number: | PF03607 |
---|---|
Interpro abstract (IPR003533): | X-linked lissencephaly is a severe brain malformation affecting males. Recently it has been demonstrated that the doublecortin gene is implicated in this disorder [ (PUBMED:9489699) ]. Doublecortin was found to bind to the microtubule cytoskeleton. In vivo and in vitro assays show that Doublecortin stabilises microtubules and causes bundling [ (PUBMED:10441322) ]. Doublecortin is a basic protein with an iso-electric point of 10, typical of microtubule-binding proteins. However, its sequence contains no known microtubule-binding domain(s). The detailed sequence analysis of Doublecortin and Doublecortin-like proteins allowed the identification of an evolutionarily conserved Doublecortin (DC) domain, which is ubiquitin-like. This domain is found in the N terminus of proteins and consists of one or two tandemly repeated copies of an around 80 amino acids region. It has been suggested that the first DC domain of Doublecortin binds tubulin and enhances microtubule polymerisation [ (PUBMED:10749977) ]. Some proteins known to contain a DC domain are listed below:
|
GO process: | intracellular signal transduction (GO:0035556) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCX