The domain within your query sequence starts at position 253 and ends at position 445; the E-value for the DC_STAMP domain shown below is 1.5e-35.

FDNIYATRQLVRQLAQAGATHLLTSPPPWLLQTAQPKLSREELLSCLLRLGLLALLLVAT
AVTVASDYGAFLLAQAAVAWAQKLPTVPITLTVKYDASYKVLDFILFVLNQPPVESVFAS
MQRSFQWELRFTPHDCHLPQAQPPRVTAALAAGALQLLAGATLVLQAYAWRLRHTIAASF
FPDQEARRLSHLQ

DC_STAMP

• PFAM accession number: PF07782
• Interpro abstract (IPR012858):

  This group of sequences is similar to a region of the dendritic cell-specific transmembrane protein (DC-STAMP, Q9H295 ). This is thought to be a novel receptor protein that shares no identity with other multimembrane-spanning proteins [ (PUBMED:11169400) ]. It is thought to have seven putative transmembrane regions [ (PUBMED:11169400) ], two of which are found in the region featured in this family. DC-STAMP is also described as having potential N-linked glycosylation sites and a potential phosphorylation site for PKC [ (PUBMED:11169400) ], but these are not conserved.

• GO component: integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DC_STAMP