SMART: Pfam domain DDA1

The domain within your query sequence starts at position 3 and ends at position 65; the E-value for the DDA1 domain shown below is 6e-34.

DFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQ
WDK

DDA1

PFAM accession number:	PF10172
Interpro abstract (IPR018276):	This entry represents the N-terminal domain of DDA1 (DET1- and DDB1-associated protein 1) ubiquitin ligase, which binds strongly with Det1 (De-etiolated 1) and DDB1 (Damaged DNA binding protein 1 associated 1). Together DDA1, DDB1 and Det1 form the DDD core complex, which recruits a specific UBE2E enzyme to form specific DDD-E2 complexes [ (PUBMED:17452440) ]. Component of the DDD-E2 complexes which may provide a platform for interaction with cul4a and WD repeat proteins. These proteins may be involved in ubiquitination and subsequent proteasomal degradation of target proteins.

PFAM accession number:

PF10172

Interpro abstract (IPR018276):

This entry represents the N-terminal domain of DDA1 (DET1- and DDB1-associated protein 1) ubiquitin ligase, which binds strongly with Det1 (De-etiolated 1) and DDB1 (Damaged DNA binding protein 1 associated 1). Together DDA1, DDB1 and Det1 form the DDD core complex, which recruits a specific UBE2E enzyme to form specific DDD-E2 complexes [ (PUBMED:17452440) ]. Component of the DDD-E2 complexes which may provide a platform for interaction with cul4a and WD repeat proteins. These proteins may be involved in ubiquitination and subsequent proteasomal degradation of target proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDA1