The domain within your query sequence starts at position 33 and ends at position 107; the E-value for the DDDD domain shown below is 1.7e-40.
TVPGSSGLSQVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALL EEHDIFVPEDDDDDD
DDDD |
![]() |
---|
PFAM accession number: | PF10161 |
---|---|
Interpro abstract (IPR018782): | Essential MCU regulator (EMRE) is a component of the mitochondrial calcium uniporter complex in metazoa, a complex that mediates calcium uptake into mitochondria. It bridges the calcium-sensing components of the complex, MICU1 and MICU2, and the pore-forming subunit MCU, and it is essential for the complex uniporter activity [ (PUBMED:24231807) ]. |
GO process: | calcium import into the mitochondrion (GO:0036444), mitochondrial calcium ion homeostasis (GO:0051560) |
GO component: | uniplex complex (GO:1990246) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDDD